PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E04323.1.p
Common NameEUGRSUZ_E04323
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 295aa    MW: 32178.2 Da    PI: 8.8317
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E04323.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171360148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
  Eucgr.E04323.1.p 13 RGLWSPEEDEKLARFITTHGHGSWSSVPKLAGLQRCGKSCRLRWINYL 60
                      788*******************************************97 PP

2Myb_DNA-binding50.93.5e-1666109146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Eucgr.E04323.1.p  66 RGSFSAQEERTIIDVHRILGNR-WSQIAKHLP-GRTDNEVKNFWNS 109
                       899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-25463IPR009057Homeodomain-like
PROSITE profilePS5129416.677860IPR017930Myb domain
SuperFamilySSF466894.12E-2910107IPR009057Homeodomain-like
SMARTSM007172.8E-121262IPR001005SANT/Myb domain
PfamPF002491.0E-151360IPR001005SANT/Myb domain
CDDcd001673.10E-111660No hitNo description
PROSITE profilePS5129425.23161115IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2564115IPR009057Homeodomain-like
SMARTSM007173.1E-1565113IPR001005SANT/Myb domain
PfamPF002491.2E-1466109IPR001005SANT/Myb domain
CDDcd001671.04E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGHHCCTKQK VKRGLWSPEE DEKLARFITT HGHGSWSSVP KLAGLQRCGK SCRLRWINYL  60
RPDLKRGSFS AQEERTIIDV HRILGNRWSQ IAKHLPGRTD NEVKNFWNSC IKKKLLAQGL  120
DPNTHNLLST TSSLKNNNGG NVNSSSSMFH MSTDSSTSNC SMDLKIPFVT LPSVPCPDQA  180
TNPICTGLFP PILHATSSSS NLVSFEYHQQ NPSASSPHGL MDLAAAGRSP SSFSSLLNSF  240
SSGLAGNGEE SSLWDCGLEA NAVLAAPRHE DTSQVQMQQQ PPGLKQANEK NGKLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E04323.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058069.10.0PREDICTED: myb-related protein Zm38
TrEMBLA0A059CAU10.0A0A059CAU1_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0003s15440.16e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79552539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.11e-82myb domain protein 67